PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0445s0025.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 326aa    MW: 35668.8 Da    PI: 8.023
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0445s0025.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.65.2e-33172229259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +Dgy+WrKYGqK vk+s++prsYYrCt+++C vkk+vers +dp++v++tYeg+Hnh+
  Kalax.0445s0025.1.p 172 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCFVKKRVERSFQDPSTVITTYEGQHNHH 229
                          8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-34156231IPR003657WRKY domain
SuperFamilySSF1182903.14E-29163231IPR003657WRKY domain
PROSITE profilePS5081132.168166231IPR003657WRKY domain
SMARTSM007742.5E-38171230IPR003657WRKY domain
PfamPF031062.7E-25172229IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MSQPNRNPYD PYPYDPFFSS LEANPNASFF SSPQEDPNSY NTNLTGHCNS YITSFNDFVH  60
GGGSVVSSSS MSTVDYVYSN NNGVAVAVAG DHSCNGSNKL PMRHSLSLSS SSAEVVGEEY  120
SGKSMVDDID HHNGDDDQSK KVRNDKQKKK GAKRAKEPRF AFVTKSEIDQ LEDGYRWRKY  180
GQKAVKNSPY PRSYYRCTTQ KCFVKKRVER SFQDPSTVIT TYEGQHNHHS PAALRGNAAA  240
MLSANAALFG GSSSSLSPGA LSSFPHHPLF TTFNNGQNAA PPLYNYNSYQ NPSNNTSSSH  300
SIVPDFGSLQ DLVNHPSSGK RESEP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-291642321078Probable WRKY transcription factor 4
2lex_A4e-291642321078Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015867035.12e-61PREDICTED: probable WRKY transcription factor 71
RefseqXP_015867036.12e-61PREDICTED: probable WRKY transcription factor 71
RefseqXP_015876832.12e-61PREDICTED: probable WRKY transcription factor 71
SwissprotQ8VWJ25e-49WRK28_ARATH; Probable WRKY transcription factor 28
TrEMBLA0A0D2S1Y17e-59A0A0D2S1Y1_G
TrEMBLW9RHT32e-58W9RHT3_9R
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.17e-45WRKY DNA-binding protein 71